PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014411m
Common NameCARUB_v10014411mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 265aa    MW: 29640.2 Da    PI: 7.296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014411mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.75.4e-083379347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE + + +a + +  +   +W ++a++++ g+t  ++ + + k+
  Carubv10014411m 33 SWTKEENKMFERALAIYAEDspdRWFKVASMIP-GKTVLDVMNQYSKL 79
                     7*****************99*************.*********99876 PP

2Myb_DNA-binding39.99.9e-13129173347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Carubv10014411m 129 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 173
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-42878IPR009057Homeodomain-like
PROSITE profilePS512939.4492982IPR017884SANT domain
SMARTSM007175.8E-93082IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-113286IPR009057Homeodomain-like
PfamPF002498.4E-73378IPR001005SANT/Myb domain
CDDcd001675.32E-83479No hitNo description
PROSITE profilePS5129419.439122178IPR017930Myb domain
SuperFamilySSF466892.51E-15124177IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17125177IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.4E-11126178IPR009057Homeodomain-like
SMARTSM007171.7E-10126176IPR001005SANT/Myb domain
PfamPF002494.3E-10129173IPR001005SANT/Myb domain
CDDcd001676.20E-9129173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
METLHPLSHL PISDHRFVFQ EMMSLQSSSS SSSWTKEENK MFERALAIYA EDSPDRWFKV  60
ASMIPGKTVL DVMNQYSKLE EDVSDIEAGR VPIPGYPAAS SPSAFDPETC RKRPNGARGS  120
DHDRKKGVPW TEEEHRRFLL GLLKYGKGDW RNISRNFVVS KTPTQVASHA QKYYQRQLSG  180
AKDKRRPSIH DITTVNLLKA NLNRSFSDHS DILPDLGFTD KDNAEEGVMF MGQNLSSETL  240
FSPSPTSFDA AFNFAGANAF SARA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-162796473RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0561800.0AY056180.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY0912650.0AY091265.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY5503080.0AY550308.1 Arabidopsis thaliana MYB transcription factor (At3g11280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298342.10.0hypothetical protein CARUB_v10014411mg
SwissprotQ8S9H76e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0I0320.0R0I032_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1170__AT3G11280.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-161MYB family protein